CJC-1295 No DAC
Growth Hormone Secretagogues
£30.00per vial
CJC-1295 No DAC is a modified 29-amino-acid analogue of growth hormone-releasing hormone, studied at the GHRH receptor. Without the Drug Affinity Complex modification it does not bind serum albumin, so laboratory work uses it to examine short-duration receptor activity against long-acting GHRH analogues.
For laboratory research only. Not for human consumption. No medical claims. This product is not intended to diagnose, treat, cure, or prevent any disease.
This vial is sealed for the protection of health and hygiene. Under regulation 28(1)(e) of the Consumer Contracts (Information, Cancellation and Additional Charges) Regulations 2013, the 14-day right to cancel is lost for this item once that seal is broken. While the seal is intact the right applies in full.
CJC-1295 No DAC cannot be listed to research users in Australia, Canada, Japan, Mexico, New Zealand, Norway, Russian Federation, Saudi Arabia, Singapore, South Korea, Switzerland, United Arab Emirates. Verify local eligibility before ordering.
Listed
- Molecular weight
- 3367.9 g/mol
- Sequence
- YA(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
- Presentation
- Pre-mixed liquid, 3ml vial
For laboratory research only. Not for human consumption. No medical claims.
- UK DISPATCH
- TRACKED SHIPPING
- COA PER BATCH
- SECURE PAYMENT
§01Compound Profile
Every batch is independently analysed by HPLC and mass spectrometry before it is listed, and the Certificate of Analysis for that batch is published in full, including the measured purity figure for that batch.
HPLC
Purity by chromatography
ANALYSED
MASS SPECTROMETRY
Identity confirmation
ANALYSED
PUBLIC COA
Every batch number resolves to its Certificate of Analysis
DOCUMENTED
§02The Science
Published constants and presentation for CJC-1295 No DAC, as catalogued.
Every figure in this list is a published constant or a presentation fact. None of it is an analytical result: the measured figures live on the Certificate of Analysis for the batch.
- Molecular weight
- 3367.9 g/mol
- Sequence
- YA(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
- Presentation
- Pre-mixed liquid, 3ml vial
- Batch reference
- CJ5603
Molecular weight source: Computed from the published tetrasubstituted GRF (1-29) sequence. Method validated against PubChem CID 16132413 (sermorelin, 3357.9), which the same calculation reproduces exactly. PubChem carries no entry for the No DAC analogue..
§03Certificate of Analysis
Every batch is independently analysed by HPLC and mass spectrometry before it is listed, and the Certificate of Analysis for that batch is published in full, including the measured purity figure for that batch.
| PARAMETER | METHOD | RESULT |
|---|---|---|
| Purity | HPLC | 98.3% |
| Identity | Mass spectrometry | Confirmed |
CJ5603 · 2026-05-26
§04Compound details
CJC-1295 No DAC, also referenced in the literature as modified GRF (1-29), is a tetrasubstituted analogue of the first 29 amino acids of growth hormone-releasing hormone. The four substitutions at positions 2, 8, 15, and 27 are made to resist enzymatic cleavage by dipeptidyl peptidase-4, which degrades native GHRH rapidly. It is studied in controlled laboratory settings for its binding at the GHRH receptor and for the intracellular cascade that follows.
The defining research variable is the absence of the Drug Affinity Complex. The DAC-modified form carries a maleimide group that conjugates to serum albumin and extends circulating duration substantially. Without it, CJC-1295 No DAC is examined for short-duration, pulsatile receptor activity, which makes it the comparator compound in study designs that isolate signalling duration as the variable rather than receptor affinity.
Preclinical investigations examine CJC-1295 No DAC in hypothalamic-pituitary axis models, cyclic-AMP second-messenger frameworks, and receptor-binding characterisation. It is catalogued here as a reference compound for laboratory research. No therapeutic, diagnostic, or clinical conclusion is drawn from any study referenced above, and none should be inferred.
CJC-1295 No DAC is listed as a pre-mixed liquid in a sealed 3ml vial, at 5mg and 10mg. It is not a lyophilised presentation and there is no reconstitution step for the research user to perform.
Every batch is independently analysed before it is listed. Purity is measured by high-performance liquid chromatography. Identity is confirmed by mass spectrometry, which is the check that distinguishes the No DAC form from the DAC-modified analogue by molecular weight. Those are the two analytical methods used, and no other method is claimed.
Each vial carries a batch number that resolves to the public Certificate of Analysis for that batch, reporting the compound, the lot reference, the HPLC result, the mass-spectrometry result, the analysis date, and the laboratory that ran it. The document is published before the batch enters the catalogue.
Research Use Only
CJC-1295 No DAC is catalogued strictly for in-vitro laboratory research. It is not for human consumption, veterinary use, or therapeutic, diagnostic or clinical application. It is not supplied as a medicinal product and it is not licensed by the MHRA.
Not a Medical Product
None of the compounds listed on this site are medicinal products, nor should they be marketed, described or used as such. No medical claims are made about CJC-1295 No DAC. Nothing on this page is medical, veterinary or scientific advice, and no guidance on preparation, administration or quantity is provided or will be provided on request.
Compliance and Responsibility
The research user is responsible for ensuring compliance with all laws and regulations governing the receipt, handling, storage, use and disposal of research chemicals in their jurisdiction, and for applying appropriate control measures under the Control of Substances Hazardous to Health Regulations 2002 or the equivalent local regime.
Analytical Scope
Analytical results published for CJC-1295 No DAC relate solely to the batch identified on the Certificate of Analysis. Two methods are used: high-performance liquid chromatography and mass spectrometry. No other analysis is performed or implied. Results for one batch do not warrant any other batch.
Jurisdiction Notice
CJC-1295 No DAC cannot be listed to research users in the following jurisdictions: Australia, Canada, Japan, Mexico, New Zealand, Norway, Russian Federation, Saudi Arabia, Singapore, South Korea, Switzerland, United Arab Emirates. It is the research user's responsibility to verify local eligibility before placing an order. Where an order is placed for a jurisdiction in which the compound cannot be listed, the order will be cancelled and refunded in full.
Research Context
CJC-1295 No DAC, also referenced in the literature as modified GRF (1-29), is a tetrasubstituted analogue of the first 29 amino acids of growth hormone-releasing hormone. The four substitutions at positions 2, 8, 15, and 27 are made to resist enzymatic cleavage by dipeptidyl peptidase-4, which degrades native GHRH rapidly. It is studied in controlled laboratory settings for its binding at the GHRH receptor and for the intracellular cascade that follows.
The defining research variable is the absence of the Drug Affinity Complex. The DAC-modified form carries a maleimide group that conjugates to serum albumin and extends circulating duration substantially. Without it, CJC-1295 No DAC is examined for short-duration, pulsatile receptor activity, which makes it the comparator compound in study designs that isolate signalling duration as the variable rather than receptor affinity.
Preclinical investigations examine CJC-1295 No DAC in hypothalamic-pituitary axis models, cyclic-AMP second-messenger frameworks, and receptor-binding characterisation. It is catalogued here as a reference compound for laboratory research. No therapeutic, diagnostic, or clinical conclusion is drawn from any study referenced above, and none should be inferred.
Analysis and Documentation
CJC-1295 No DAC is listed as a pre-mixed liquid in a sealed 3ml vial, at 5mg and 10mg. It is not a lyophilised presentation and there is no reconstitution step for the research user to perform.
Every batch is independently analysed before it is listed. Purity is measured by high-performance liquid chromatography. Identity is confirmed by mass spectrometry, which is the check that distinguishes the No DAC form from the DAC-modified analogue by molecular weight. Those are the two analytical methods used, and no other method is claimed.
Each vial carries a batch number that resolves to the public Certificate of Analysis for that batch, reporting the compound, the lot reference, the HPLC result, the mass-spectrometry result, the analysis date, and the laboratory that ran it. The document is published before the batch enters the catalogue.
Compliance Notice
Research Use Only
CJC-1295 No DAC is catalogued strictly for in-vitro laboratory research. It is not for human consumption, veterinary use, or therapeutic, diagnostic or clinical application. It is not supplied as a medicinal product and it is not licensed by the MHRA.
Not a Medical Product
None of the compounds listed on this site are medicinal products, nor should they be marketed, described or used as such. No medical claims are made about CJC-1295 No DAC. Nothing on this page is medical, veterinary or scientific advice, and no guidance on preparation, administration or quantity is provided or will be provided on request.
Compliance and Responsibility
The research user is responsible for ensuring compliance with all laws and regulations governing the receipt, handling, storage, use and disposal of research chemicals in their jurisdiction, and for applying appropriate control measures under the Control of Substances Hazardous to Health Regulations 2002 or the equivalent local regime.
Analytical Scope
Analytical results published for CJC-1295 No DAC relate solely to the batch identified on the Certificate of Analysis. Two methods are used: high-performance liquid chromatography and mass spectrometry. No other analysis is performed or implied. Results for one batch do not warrant any other batch.
Jurisdiction Notice
CJC-1295 No DAC cannot be listed to research users in the following jurisdictions: Australia, Canada, Japan, Mexico, New Zealand, Norway, Russian Federation, Saudi Arabia, Singapore, South Korea, Switzerland, United Arab Emirates. It is the research user's responsibility to verify local eligibility before placing an order. Where an order is placed for a jurisdiction in which the compound cannot be listed, the order will be cancelled and refunded in full.
§05Related compounds
§06Questions
No. CJC-1295 No DAC is catalogued strictly for in-vitro laboratory research. It is not for human or veterinary consumption and no medical claims are made.
GHRH receptor binding and the downstream signalling cascade, in laboratory endocrine models. Findings are preclinical.
It indicates the peptide carries no Drug Affinity Complex modification. The DAC form conjugates to serum albumin and acts over a much longer window, so the No DAC form is used where short-duration receptor activity is the variable being isolated.
They are the same compound. CJC-1295 No DAC and modified GRF (1-29) are two names for the tetrasubstituted 29-amino-acid GHRH analogue listed on this page.
Pre-mixed liquid in a sealed 3ml vial, at 5mg and 10mg. It is not a lyophilised powder and needs no preparation before laboratory use.
Every batch has a document.
The Certificate of Analysis for a batch is published when that batch is released. Your batch number resolves to the report.
For laboratory research only. Not for human consumption. No medical claims.
